Protein coding transcript 42322

• Transcript: Ll_transcript_526860
• CDS coordinates: 1153-1872 (+)
• Peptide sequence: MSRPQDPPRSFFPFGRNPFWMRSPKGTNLSPQLLAILHAFEATLEERLKKLMPKSKDEILCLSWMTLAMQSLCETHHDIENLIANLELPVGDWDEKWIDLYLDISVKLLDICIAFSSELSRLNHSNLLLQCALHSLNSASPKQFVRASSSLDGWRQHIGSKNPRIDKCGAILDNLVGSLDLPKVKKSAKGKVLMQAMYGVKLMTVFVCNVFAVTFSCSAKLSDLDVADMYSWAPAFKRLQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_526860

• Blastp: Protein BPS1, chloroplastic from Arabidopsis with 58.51% of identity
• Blastx: Protein BPS1, chloroplastic from Arabidopsis with 58.51% of identity
• Eggnog: protein BPS1, chloroplastic-like(ENOG410YDX5)
• Kegg: Link to kegg annotations (AT1G01550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460245.1)
• Pfam: Protein BYPASS1-related (PF05633.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;