Transcript | Ll_transcript_526882 |
---|---|
CDS coordinates | 279-998 (+) |
Peptide sequence | MSRPQDPPRSFFPFGRNPFWMRSPKGTNLSPQLLAILHAFEATLEERLKKLMPKSKDEILCLSWMTLAMQSLCETHHDIENLIANLELPVGDWDEKWIDLYLDISVKLLDICIAFSSELSRLNHSNLLLQCALHSLNSASPKQFVRASSSLDGWRQHIGSKNPRIDKCGAILDNLVGSLDLPKVKKSAKGKVLMQAMYGVKLMTVFVCNVFAVTFSCSAKLSDLDVADMYSWAPAFKRLQ |
ORF Type | 3prime_partial |
Blastp | Protein BPS1, chloroplastic from Arabidopsis with 58.51% of identity |
---|---|
Blastx | Protein BPS1, chloroplastic from Arabidopsis with 58.51% of identity |
Eggnog | protein BPS1, chloroplastic-like(ENOG410YDX5) |
Kegg | Link to kegg annotations (AT1G01550) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460245.1) |
Pfam | Protein BYPASS1-related (PF05633.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer