Transcript | Ll_transcript_526151 |
---|---|
CDS coordinates | 81-644 (+) |
Peptide sequence | MIPTTPLPSSSTGIEIKDQVPRGSNTEPIPPPIPANHGGESRSMNFKRWFPWLVPSFVVANVALFVITMYKNNCPKHSIPDSCFAPFLGRFSFQPLKQNPLLGPSSSTLENMGALQVDKVVHRHQVWRLFSCVWLHGGVVHVLANMLSLVFIGIRLEQEFGFGTVLGYHLCVCSATIYVHKQHCSNI* |
ORF Type | complete |
Blastp | RHOMBOID-like protein 1 from Arabidopsis with 74.36% of identity |
---|---|
Blastx | RHOMBOID-like protein 1 from Arabidopsis with 74.36% of identity |
Eggnog | rhomboid family(COG0705) |
Kegg | Link to kegg annotations (AT2G29050) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454071.1) |
Pfam | Rhomboid family (PF01694.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer