Protein coding transcript 42378

• Transcript: Ll_transcript_525194
• CDS coordinates: 2482-2922 (+)
• Peptide sequence: MGTHTVAAHQVMIQTFVMCTVWGEPLSQTAQSFMPELIYGANRSLSKARLLLRSLVIIGATLGFFLGIVGTCVPWLFPHIFTHDQVVIGEMHKVLLPYFVGLAVTPPTHSLEGTLMAGRDLNFMSLSMTGCLCLGSLVLWFLSSRSG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_525194

• Blastp: Protein DETOXIFICATION 46, chloroplastic from Arabidopsis with 68.75% of identity
• Blastx: Protein DETOXIFICATION 47, chloroplastic from Arabidopsis with 64.38% of identity
• Eggnog: Mate efflux family protein(COG0534)
• Kegg: Link to kegg annotations (AT2G21340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003607027.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;