Protein coding transcript 42384

• Transcript: Ll_transcript_525205
• CDS coordinates: 157-564 (+)
• Peptide sequence: MSLNLTLSPFPLSSFPNHLLRRRFLLHNASLTPNLRLTASKHRFVTSRVAGGQELTTDSDNNNRNQRINVDEESGNESEKKELSEQSIWNQMKEIVMFTGPATGLWICGPLMSLIDTAVIGQGSSIQLAALGIIG*
• ORF Type: complete

Annotations of Ll_transcript_525205

• Blastp: Protein DETOXIFICATION 46, chloroplastic from Arabidopsis with 42.86% of identity
• Blastx: Protein DETOXIFICATION 46, chloroplastic from Arabidopsis with 51.46% of identity
• Eggnog: Mate efflux family protein(COG0534)
• Kegg: Link to kegg annotations (AT2G21340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413620.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;