Protein coding transcript 42402

• Transcript: Ll_transcript_525197
• CDS coordinates: 60-932 (+)
• Peptide sequence: MGAPDSRNRNESLLLALTKHLSLDSSVIPAGSLDGDVKSLYLSIAAASGNEDSHSSDEVLKWVAFAEAFPEALEARFEDLKKLNDELSGKSVLLGNGLKPSEADVIVFSVIHSSLINLSDANKEKLPHVFRWADYIQHKEKFVGLFEEILLHKPEFEPPVTKPAGAVEADLKSNKADQSIKNENKSEADISKDKNKAENIKGKSAGDREPDKAKAKSAVKEPSKGKAKPAEKVPDKDAELSVSLLNIQVGLIRKASKHPSADRSSGRLTGKTFLIQQNVKLRNIVDAYVS*
• ORF Type: complete

Annotations of Ll_transcript_525197

• Blastp: tRNA-aminoacylation cofactor arc1 from Schizosaccharomyces with 28.22% of identity
• Blastx: Methionine--tRNA ligase, cytoplasmic from Arabidopsis with 31.95% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC30C2.04)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415725.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;