| Transcript | Ll_transcript_495936 |
|---|---|
| CDS coordinates | 723-1094 (+) |
| Peptide sequence | MECLEEFYATYDDTKLRWSGADLLTRVAKKFLGEEINSMKQLKLKVEPSYIFFPISSGNITRYFIAPATKTEKAEQEVLLEKIVQESLTFHFWNSLTSSLIPEPDSLVAKLMNHACIRCLELL* |
| ORF Type | complete |
| Blastp | Uncharacterized protein At4g19900 from Arabidopsis with 58.54% of identity |
|---|---|
| Blastx | Uncharacterized protein At4g19900 from Arabidopsis with 58.02% of identity |
| Eggnog | lactosylceramide(ENOG4111PD8) |
| Kegg | Link to kegg annotations (AT4G19900) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019423742.1) |
| Pfam | Alpha 1,4-glycosyltransferase conserved region (PF04572.11) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer