Transcript | Ll_transcript_524966 |
---|---|
CDS coordinates | 152-727 (+) |
Peptide sequence | MGSIVLFSSAILVVLLLVAGFARSDLSKDRDECADKLVGLANCLPYVGGEVKTPTIDCCSGLKVVLDTNKKCICILIKDRDDPTLGFKINATLAVQLPTACHTPANISQCVDLLHLAPNSSEAKVFEGFEKSTKTNSSVPSDSSGSGEKGSSSSARSEEKSGGGWGERWVVAKVVAGLLPFLFIFHFFCLL* |
ORF Type | complete |
Blastp | Protein YLS3 from Arabidopsis with 38.81% of identity |
---|---|
Blastx | Protein YLS3 from Arabidopsis with 51.85% of identity |
Eggnog | Non-specific lipid-transfer protein-like protein(ENOG410YR9F) |
Kegg | Link to kegg annotations (AT2G44290) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414694.1) |
Pfam | Probable lipid transfer (PF14368.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer