Protein coding transcript 42524

• Transcript: Ll_transcript_524976
• CDS coordinates: 152-646 (+)
• Peptide sequence: MGSIVLFSSAILVVLLLVAGFARSDLSKDRDECADKLVGLANCLPYVGGEVKTPTIDCCSGLKVVLDTNKKCICILIKDRDDPTLGFKINATLAVQLPTACHTPANISQCVDLLHLAPNSSEAKVFEGFEKSTKTNSSVPSDSSGNETVSYLIVLLLFWYMKSM*
• ORF Type: complete

Annotations of Ll_transcript_524976

• Blastp: Protein YLS3 from Arabidopsis with 43.84% of identity
• Blastx: Protein YLS3 from Arabidopsis with 47.24% of identity
• Eggnog: Non-specific lipid-transfer protein-like protein(ENOG410YR9F)
• Kegg: Link to kegg annotations (AT2G44290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414694.1)
• Pfam: Probable lipid transfer (PF14368.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;