Transcript | Ll_transcript_525141 |
---|---|
CDS coordinates | 177-1007 (+) |
Peptide sequence | MGRSPCCSKDGLNKGAWSPNEDKILIEYIKVHGEGRWRNIPQIAGLKRCGKSCRLRWLNYLRPDIKRGNISSDEEDLIIRLHNLLGNRWSLIAGRLPGRTDNEIKNYWNNHLGKKVKDGHQIITNAKSIENPKPNGIPKIKVKVTASPSQLKLDTDMVLTKTNMCSSVLIKNPISNSSKAENSICNNDSVSDQIEPNENSGFLSFINKEEKELTTDLLKDFMVREDICSSDILNSDFSNMCDFSYSDNMCDSLSDEILMDWTQSSLADETNVSNRE* |
ORF Type | complete |
Blastp | Anthocyanin regulatory C1 protein from Zea with 75.89% of identity |
---|---|
Blastx | Anthocyanin regulatory C1 protein from Zea with 75.89% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (541757) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436210.1) |
Pfam | Myb-like DNA-binding domain (PF00249.30) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer