Protein coding transcript 427

• Transcript: Ll_transcript_401770
• CDS coordinates: 3-506 (+)
• Peptide sequence: FSMIFFLIFLHVSPLVTSTPPPKSLNDPFLKCLTNHTSFSNQVSNFVFDQTNASYASILQAYIRNAKFNISTTPKPLIIVTPLNEHHVQGAVVCAKSNGVEIRIRSGGHDYEGISYVSKAPFIILDMFNMRNVTIDVQNEVAVVQSGATTGELYYNIWKKSKVHGFPA
• ORF Type: internal

Annotations of Ll_transcript_401770

• Blastp: Berberine bridge enzyme-like 2 from Arabidopsis with 49.11% of identity
• Blastx: Berberine bridge enzyme-like 2 from Arabidopsis with 49.11% of identity
• Eggnog: FAD linked oxidase domain protein(COG0277)
• Kegg: Link to kegg annotations (AT1G11770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462825.1)
• Pfam: FAD binding domain (PF01565.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;