Transcript | Ll_transcript_358789 |
---|---|
CDS coordinates | 109-888 (+) |
Peptide sequence | MTVTSWFLVASWFMAPFVFNPSGFDWLKTVYDFDDFMNWIWYKGSVFAKAEQSWERWWYEEQDHLKVTGLWGKLFEIILDLRFFFFQYGIVFHLGVAAESTSIAVYLLSWIFVFVAFGISVVIAYARNRYAAKEHILYRLVQFLVIILSILVIVVLLEFTSFKFVDLFTSLLAFIPTGWGLLSIAQVFRPFLQSSIIWNGVVSMARLYDTMFGVIVMAPVALLSWLPGVQNMQTKILFNEAFSRGLRISQIVTGKKSKA* |
ORF Type | complete |
Blastp | Callose synthase 12 from Arabidopsis with 70.95% of identity |
---|---|
Blastx | Callose synthase 12 from Arabidopsis with 70.95% of identity |
Eggnog | synthase(ENOG410XQ8V) |
Kegg | Link to kegg annotations (AT4G03550) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449022.1) |
Pfam | 1,3-beta-glucan synthase component (PF02364.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer