Protein coding transcript 428

• Transcript: Ll_transcript_401783
• CDS coordinates: 3-404 (+)
• Peptide sequence: KILIQAHAEIGNKWAEIAKRLPGRTENSIKNHWNATKRRQYSKRKCCSKYPRGTILQDYIKSLNLDKNTPKDYTTQPSSNTMRKKASTMKSAAAAIATQPHSTSHVSSNDRLVPNYEFNEDPDFCFHGNIFQEG
• ORF Type: internal

Annotations of Ll_transcript_401783

• Blastp: Transcription factor MYB98 from Arabidopsis with 50% of identity
• Blastx: Transcription factor MYB98 from Arabidopsis with 50% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT4G18770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464038.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;