Protein coding transcript 42864

• Transcript: Ll_transcript_361135
• CDS coordinates: 115-468 (+)
• Peptide sequence: MARELSIIMIFLVVMLLLPVENTEIVVTTIEAPAPQPNNITNHFPNQGITEGSLQPQECGPRCTDRCSKTQYKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP*
• ORF Type: complete

Annotations of Ll_transcript_361135

• Blastp: Protein GAST1 from Lycopersicon with 84.29% of identity
• Blastx: Protein GAST1 from Lycopersicon with 84.29% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (101248254)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425696.1)
• Pfam: Gibberellin regulated protein (PF02704.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;