Transcript | Ll_transcript_361135 |
---|---|
CDS coordinates | 115-468 (+) |
Peptide sequence | MARELSIIMIFLVVMLLLPVENTEIVVTTIEAPAPQPNNITNHFPNQGITEGSLQPQECGPRCTDRCSKTQYKKPCMFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKRGGPKCP* |
ORF Type | complete |
Blastp | Protein GAST1 from Lycopersicon with 84.29% of identity |
---|---|
Blastx | Protein GAST1 from Lycopersicon with 84.29% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (101248254) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425696.1) |
Pfam | Gibberellin regulated protein (PF02704.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer