| Transcript | Ll_transcript_361136 |
|---|---|
| CDS coordinates | 164-532 (+) |
| Peptide sequence | MTRQLTFPMLFLAAILLLLLLVQSHAEIVVTTNEAPAPSPHHSRSGTHFPMHGITEGSLQPQECSPRCADRCSNTQYRKPCLFFCQKCCAKCLCVPPGTYGNKQVCPCYNNWKTKEGGPKCP* |
| ORF Type | complete |
| Blastp | Protein GAST1 from Lycopersicon with 75% of identity |
|---|---|
| Blastx | Protein GAST1 from Lycopersicon with 75% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (101248254) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019426980.1) |
| Pfam | Gibberellin regulated protein (PF02704.13) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer