Protein coding transcript 429

• Transcript: Ll_transcript_401786
• CDS coordinates: 1-330 (+)
• Peptide sequence: TRLVETSGGDLRRAITSLQSCARLKGGEPITEEDVIEVAGVVPKQCITDIISASRTNRYETIENCLEKIMSEAYSASQILEQLQEFILDDHETPDMAKAQICEKLSVCNF
• ORF Type: internal

Annotations of Ll_transcript_401786

• Blastp: Replication factor C subunit 4 from Mus with 36.54% of identity
• Blastx: Replication factor C subunit 4 from Mus with 36.54% of identity
• Eggnog: DNA polymerase III subunit delta'(COG0470)
• Kegg: Link to kegg annotations (106344)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020984395.1)
• Pfam: Replication factor C C-terminal domain (PF08542.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;