Protein coding transcript 42926

• Transcript: Ll_transcript_360120
• CDS coordinates: 1170-1991 (+)
• Peptide sequence: MSRKAFLDLSFLLRSCTPHSAIFQAKQCHAQTILQGLLPNVTLENDLLLVYSRYSLCCYARKVFDRMLRRNMHSWNIMIASCVKDSMYNDVLTIFSELKRHGLQPDHYTLPSLFKAALGVCDAWLGKICHGWVIKLGYEGYVVVGSSVLEFYIKCGDMPQARSVFSNMLCRDHVVWNLMISGFGNAELYSEAINCFREMLVLNGVKVDYMIVPSILNACGREGDLMKGKEVHGYVVKNFAFDADAPIGNALIDMYGKCGCLNDSETVSGHCAA*
• ORF Type: complete

Annotations of Ll_transcript_360120

• Blastp: Pentatricopeptide repeat-containing protein At5g04780, mitochondrial from Arabidopsis with 31.62% of identity
• Blastx: Pentatricopeptide repeat-containing protein At5g04780, mitochondrial from Arabidopsis with 31.62% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT5G04780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418560.1)
• Pfam: PPR repeat family (PF13041.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;