Protein coding transcript 42928

• Transcript: Ll_transcript_360092
• CDS coordinates: 908-1507 (+)
• Peptide sequence: MSRKAFLDLSFLLRSCTPHSAIFQAKQCHAQTILQGLLPNVTLENDLLLVYSRYSLCCYARKVFDRMLRRNMHSWNIMIASCVKDSMYNDVLTIFSELKRHGLQPDHYTLPSLFKAALGVCDAWLGKICHGWVIKLGYEGYVVVGSSVLEFYIKCGDMPQARSVFSNMLCRDHVVWNLMISGFGNAELYSEAINCFREML
• ORF Type: 3prime_partial

Annotations of Ll_transcript_360092

• Blastp: Pentatricopeptide repeat-containing protein At5g52850, chloroplastic from Arabidopsis with 36.05% of identity
• Blastx: Pentatricopeptide repeat-containing protein At5g04780, mitochondrial from Arabidopsis with 33.87% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT5G52850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020985383.1)
• Pfam: PPR repeat family (PF13041.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;