Transcript | Ll_transcript_360105 |
---|---|
CDS coordinates | 378-860 (+) |
Peptide sequence | MSRKAFLDLSFLLRSCTPHSAIFQAKQCHAQTILQGLLPNVTLENDLLLVYSRYSLCCYARKVFDRMLRRNMHSWNIMIASCVKDSMYNDVLTIFSELKRHGLQPDHYTLPSLFKAALGVCDAWLGKICHGWVIKLGYEGYVVVGSSVLEFYIKCGDMLS* |
ORF Type | complete |
Blastp | Pentatricopeptide repeat-containing protein At5g52850, chloroplastic from Arabidopsis with 38.28% of identity |
---|---|
Blastx | Pentatricopeptide repeat-containing protein At5g04780, mitochondrial from Arabidopsis with 35.17% of identity |
Eggnog | Pentatricopeptide repeat-containing protein(ENOG410Z7Z7) |
Kegg | Link to kegg annotations (AT5G52850) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020985383.1) |
Pfam | PPR repeat family (PF13041.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer