Protein coding transcript 42963

• Transcript: Ll_transcript_360827
• CDS coordinates: 206-772 (+)
• Peptide sequence: MENLNLALVSSPKPLLLGHFSATDATTKDFFRRKSFSFGRVFIAPSLSRYHVTRAAAKSHQNPISVQEKRIVEHFASISSSNSQGTTSSIGVNPQLSSPPSSTIGSPLFWIGVGVGFSALFSMVASRLKVSATLLQDMGISWSVLRVHCIYGCKIEIYWLSRFANCNKNSFILIFCTKKYKVKSYIMP*
• ORF Type: complete

Annotations of Ll_transcript_360827

• Blastp: Protein TIC 40, chloroplastic from Pisum with 71.27% of identity
• Blastx: Protein TIC 40, chloroplastic from Pisum with 90.23% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419004.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;