Protein coding transcript 42979

• Transcript: Ll_transcript_361114
• CDS coordinates: 44-454 (+)
• Peptide sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA*
• ORF Type: complete

Annotations of Ll_transcript_361114

• Blastp: Histone H3.3 from Silurana with 97.79% of identity
• Blastx: Histone H3.3 from Silurana with 97.79% of identity
• Eggnog: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling(COG2036)
• Kegg: Link to kegg annotations (100038101)
• CantataDB: Link to cantataDB annotations (CNT0000247)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004488709.1)
• Pfam: Core histone H2A/H2B/H3/H4 (PF00125.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;