Protein coding transcript 42980

• Transcript: Ll_transcript_361115
• CDS coordinates: 44-454 (+)
• Peptide sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA*
• ORF Type: complete

Annotations of Ll_transcript_361115

• Blastp: Histone H3.2 from Triticum with 100% of identity
• Blastx: Histone H3.2 from Triticum with 100% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000247)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004488709.1)
• Pfam: Core histone H2A/H2B/H3/H4 (PF00125.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;