Protein coding transcript 43041

• Transcript: Ll_transcript_359892
• CDS coordinates: 157-504 (+)
• Peptide sequence: MLTSVYSVDLPLLRWKKSALLAATSIITNVAVIGTLPYYFHMQTRVFKRPATFPRPLIFCVAILSLYCLVISLFKDIPDIEGDKEYGVQSLSIILGQKPVFWICISLLQMGYGATI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_359892

• Blastp: Naringenin 8-dimethylallyltransferase 2, chloroplastic from Sophora with 65.52% of identity
• Blastx: Naringenin 8-dimethylallyltransferase 2, chloroplastic from Sophora with 64.66% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418962.1)
• Pfam: UbiA prenyltransferase family (PF01040.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;