Protein coding transcript 43150

• Transcript: Ll_transcript_359521
• CDS coordinates: 157-567 (+)
• Peptide sequence: MASSSMTISPRKLHSDLYSYSYQENSSTPLVINVLASLIERTMARTKRIVKNGSWSLSKAISTNIFDCSEIPDMTIQSYLERIFRYTRAGPSVFVVAYVYIDRFCQNNPGFRINARNVHRLLITTIMVASKYVEDM*
• ORF Type: complete

Annotations of Ll_transcript_359521

• Blastp: Cyclin-U2-2 from Arabidopsis with 73.88% of identity
• Blastx: Cyclin-U2-2 from Arabidopsis with 70.14% of identity
• Eggnog: Cyclin-dependent protein kinase(ENOG4111TTK)
• Kegg: Link to kegg annotations (AT3G60550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464999.1)
• Pfam: Cyclin (PF08613.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;