Transcript | Ll_transcript_359526 |
---|---|
CDS coordinates | 157-567 (+) |
Peptide sequence | MASSSMTISPRKLHSDLYSYSYQENSSTPLVINVLASLIERTMARTKRIVKNGSWSLSKAISTNIFDCSEIPDMTIQSYLERIFRYTRAGPSVFVVAYVYIDRFCQNNPGFRINARNVHRLLITTIMVASKYVEDM* |
ORF Type | complete |
Blastp | Cyclin-U2-2 from Arabidopsis with 73.88% of identity |
---|---|
Blastx | Cyclin-U2-2 from Arabidopsis with 70.14% of identity |
Eggnog | Cyclin-dependent protein kinase(ENOG4111TTK) |
Kegg | Link to kegg annotations (AT3G60550) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464999.1) |
Pfam | Cyclin (PF08613.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer