Protein coding transcript 43190

• Transcript: Ll_transcript_360573
• CDS coordinates: 278-673 (+)
• Peptide sequence: MDPEYLRTYQLTDKSDVYSFGVLLVETMTGRYPIEPKKAINERITIRWAMQVQKEGDAVIAMDPRLRRSPASVKAVNKVLNLAFHCLAPSKQARPSMKSCAEVLWAIRKVFRDETLSYDPTLPSHHPETFP*
• ORF Type: complete

Annotations of Ll_transcript_360573

• Blastp: Calmodulin-binding receptor-like cytoplasmic kinase 2 from Arabidopsis with 58.41% of identity
• Blastx: Calmodulin-binding receptor-like cytoplasmic kinase 2 from Arabidopsis with 64.07% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G00330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004490569.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;