Transcript | Ll_transcript_360841 |
---|---|
CDS coordinates | 1031-1417 (+) |
Peptide sequence | MLVFSCHWYCRTVLDDYMCGVRKMACEILDFMAEGLNIEPNNVFSKLLMDKESDSLFRMNHYPACPEQGEDGDENIIGFGEHTDPQIISLLRSNNTSGLQISLRDGSWISVPSDHSSFFINVGDSLQV* |
ORF Type | complete |
Blastp | Gibberellin 2-beta-dioxygenase 1 from Pisum with 79.66% of identity |
---|---|
Blastx | Gibberellin 2-beta-dioxygenase 1 from Pisum with 79.66% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443801.1) |
Pfam | 2OG-Fe(II) oxygenase superfamily (PF03171.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer