| Transcript | Ll_transcript_360842 |
|---|---|
| CDS coordinates | 153-554 (+) |
| Peptide sequence | MLSKSPTEQYTYVRNCKQTTFSSEIPLVDLSKPDIAKSLIVNACEEYGFFKVINHGVSMETMTKLESEAMNFFSLPLIEKEKAGPANPFGYGNKSIGQSGDVGWLEYLLLTTNQEYNSPTLSSAFGQNTEKFR* |
| ORF Type | complete |
| Blastp | Gibberellin 2-beta-dioxygenase 1 from Pisum with 66.92% of identity |
|---|---|
| Blastx | Gibberellin 2-beta-dioxygenase 1 from Pisum with 66.92% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019443801.1) |
| Pfam | non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer