Transcript | Ll_transcript_360844 |
---|---|
CDS coordinates | 153-1148 (+) |
Peptide sequence | MLSKSPTEQYTYVRNCKQTTFSSEIPLVDLSKPDIAKSLIVNACEEYGFFKVINHGVSMETMTKLESEAMNFFSLPLIEKEKAGPANPFGYGNKSIGQSGDVGWLEYLLLTTNQEYNSPTLSSAFGQNTEKFRTVLDDYMCGVRKMACEILDFMAEGLNIEPNNVFSKLLMDKESDSLFRMNHYPACPEQGEDGDENIIGFGEHTDPQIISLLRSNNTSGLQISLRDGSWISVPSDHSSFFINVGDSLQVMTNGRFRSVRHRVVANGFKSRLSMIYFVGPPLSEKIAPLPSLMKGKESLYKEFTWFEYKTSNYASRLADNRLGHFERIAAS* |
ORF Type | complete |
Blastp | Gibberellin 2-beta-dioxygenase 1 from Pisum with 75.83% of identity |
---|---|
Blastx | Gibberellin 2-beta-dioxygenase 1 from Pisum with 75.83% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443801.1) |
Pfam | non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer