Protein coding transcript 43290

• Transcript: Ll_transcript_360849
• CDS coordinates: 200-652 (+)
• Peptide sequence: MSSKSPTEQYTYVRNCKQTTFCSGIPLVDLSKPDAKSLIVNACEEFGFFKVINHGVPMEAISMLESEAMNFFSMPIIEKQKAGPANPFGYGNKSIGRGGDVGWVEFLLLKTNQEHNSPTLSSAFGQNRENFRSVLNEYMCGVRKMACEILD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_360849

• Blastp: Gibberellin 2-beta-dioxygenase 1 from Pisum with 65.56% of identity
• Blastx: Gibberellin 2-beta-dioxygenase 1 from Pisum with 65.56% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424643.1)
• Pfam: non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;