Protein coding transcript 43293

• Transcript: Ll_transcript_360861
• CDS coordinates: 231-845 (+)
• Peptide sequence: MTILQFSFIRKTKEQKPYVNPDLNPVLLVPGIGGSILNAVDEQNGTEERVWVRFLSAEYKLKTKLWSRYDPSTGKTESLDTNTRITVPEDRNGLYALDILDPDLLIGYESVYYFHDLIIQMLKWGYQEGKTLFGFGYDFRQSNRLQETMDRLAAKLESVYNAAGGKKIDIISHSMGGLLVKCFMGLHSDVTYPLTFSNQFNFVL*
• ORF Type: complete

Annotations of Ll_transcript_360861

• Blastp: Lecithin-cholesterol acyltransferase-like 4 from Arabidopsis with 53.55% of identity
• Blastx: Lecithin-cholesterol acyltransferase-like 4 from Arabidopsis with 70% of identity
• Eggnog: Acyl-transferase(ENOG410Y9CF)
• Kegg: Link to kegg annotations (AT4G19860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423651.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;