Transcript | Ll_transcript_360870 |
---|---|
CDS coordinates | 2393-2860 (+) |
Peptide sequence | MLQLIECPSIYELMGSPNFNWQHIPLLELWHEKHHSDGKSDIILESYPPGDSIEVLKEALANNTVNYDGKDLPLPFNLEIMKWANKTWEILSSAKLPSEVKFYNIYGTSLGTAHSVCYGNEDNPVSDLQQLHSLQAKHIYVDGDGTVPIESAKVC* |
ORF Type | complete |
Blastp | Lecithin-cholesterol acyltransferase-like 4 from Arabidopsis with 59.6% of identity |
---|---|
Blastx | Lecithin-cholesterol acyltransferase-like 4 from Arabidopsis with 70% of identity |
Eggnog | Acyl-transferase(ENOG410Y9CF) |
Kegg | Link to kegg annotations (AT4G19860) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423651.1) |
Pfam | Lecithin:cholesterol acyltransferase (PF02450.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer