Protein coding transcript 43295

• Transcript: Ll_transcript_360870
• CDS coordinates: 2393-2860 (+)
• Peptide sequence: MLQLIECPSIYELMGSPNFNWQHIPLLELWHEKHHSDGKSDIILESYPPGDSIEVLKEALANNTVNYDGKDLPLPFNLEIMKWANKTWEILSSAKLPSEVKFYNIYGTSLGTAHSVCYGNEDNPVSDLQQLHSLQAKHIYVDGDGTVPIESAKVC*
• ORF Type: complete

Annotations of Ll_transcript_360870

• Blastp: Lecithin-cholesterol acyltransferase-like 4 from Arabidopsis with 59.6% of identity
• Blastx: Lecithin-cholesterol acyltransferase-like 4 from Arabidopsis with 70% of identity
• Eggnog: Acyl-transferase(ENOG410Y9CF)
• Kegg: Link to kegg annotations (AT4G19860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423651.1)
• Pfam: Lecithin:cholesterol acyltransferase (PF02450.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;