Transcript | Ll_transcript_358874 |
---|---|
CDS coordinates | 333-845 (+) |
Peptide sequence | MPPPPTTPIHGDPESKPTSNLLPLLLKPIIMFLLTSLFFLFLGFAAFLLLHLFLLGSALHRLRFCPNPNPTPNLNNLPRFRISRGSEPAPQSRCVVCLDGFRNGQWCRKLAGCGHLFHRRCVDTWLIKVAACPTCRTPVRFNAEADVAMNQDGRQFWNCATNTNALTMLL* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | RING-H2 finger protein ATL56 from Arabidopsis with 55.13% of identity |
Eggnog | zinc ion binding(ENOG41121N2) |
Kegg | Link to kegg annotations (AT2G18670) |
CantataDB | Link to cantataDB annotations (CNT0000719) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453984.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer