Protein coding transcript 43375

• Transcript: Ll_transcript_358866
• CDS coordinates: 250-753 (+)
• Peptide sequence: MPPPSIHGDPHSKPNSNLLSLFLKPIIMLLLTSLFFLFLGFAAFLLLHLFLLGSALHRLRFCPNPNPTPNLNNLPRFRISRGSEPAPQSRCVVCLDGFRNGQWCRKLAGCGHLFHRRCVDTWLIKVAACPTCRTPVRFNAEADVAMNQDGRQFWNCATNTNALTMLL*
• ORF Type: complete

Annotations of Ll_transcript_358866

• Blastp: -
• Blastx: RING-H2 finger protein ATL56 from Arabidopsis with 55.13% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT2G18670)
• CantataDB: Link to cantataDB annotations (CNT0000719)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453984.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;