| Transcript | Ll_transcript_359620 |
|---|---|
| CDS coordinates | 1398-1718 (+) |
| Peptide sequence | MFLAGKVEETPRPLKDVILISYEIIHKKDSAAAQRIKQKVFYNFLCFHYFISYILVLDFSEITLLLGYNACSDMDGASILNSYKMFGWLVNYDNHFCLHVSLLLTT* |
| ORF Type | complete |
| Blastp | Cyclin-T1-3 from Oryza sativa with 90.48% of identity |
|---|---|
| Blastx | Cyclin-T1-3 from Oryza sativa with 87.76% of identity |
| Eggnog | NA(ENOG410ZAZC) |
| Kegg | Link to kegg annotations (4349827) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019419549.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer