Protein coding transcript 43515

• Transcript: Ll_transcript_360638
• CDS coordinates: 959-1501 (+)
• Peptide sequence: MAASLGFPFTSAQWKELERQAMIYKYMMASVPVPPHLLIPSYSSSTLNGGFNLRLSSSDPEPGRCRRTDGKKWRCSRDVAPNHKYCERHMHRGRPRSRKPVEVHTNNNNQNQIKRARNDSNPFPTTDNITTRKVVSTSQCVASGTNQQYLHSSSLSLHNFGVKTRNFDSVASVPSNKETR*
• ORF Type: complete

Annotations of Ll_transcript_360638

• Blastp: Growth-regulating factor 7 from Arabidopsis with 36.84% of identity
• Blastx: Growth-regulating factor 7 from Arabidopsis with 61.82% of identity
• Eggnog: WRC(ENOG4111821)
• Kegg: Link to kegg annotations (AT5G53660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417340.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;