Transcript | Ll_transcript_360640 |
---|---|
CDS coordinates | 1321-1809 (+) |
Peptide sequence | MLLYFSLCLFFHCFLKSAFLFHFFSFGLVNGGFNLRLSSSDPEPGRCRRTDGKKWRCSRDVAPNHKYCERHMHRGRPRSRKPVEVHTNNNNQNQIKRARNDSNPFPTTDNITTRKVVSTSQCVASGTNQQYLHSSSLSLHNFGVKTRNFDSVASVPSNKETR* |
ORF Type | complete |
Blastp | Growth-regulating factor 7 from Arabidopsis with 36.84% of identity |
---|---|
Blastx | Growth-regulating factor 10 from Oryza sativa with 56.82% of identity |
Eggnog | WRC(ENOG4111821) |
Kegg | Link to kegg annotations (AT5G53660) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433510.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer