Protein coding transcript 43521

• Transcript: Ll_transcript_360632
• CDS coordinates: 2-394 (+)
• Peptide sequence: LSSNDPEPGRCRRTDGKKWRCSRDVAPNHKYCERHMHRGRPRSRKPVEVHINNNNNDNQNQIKRARHDSNPFPASDVSVSISNNTTTKKDGCASQFVSSGASNPYLDASSLSLHHNFDSVASVSSNKEPR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_360632

• Blastp: Growth-regulating factor 12 from Oryza sativa with 85.11% of identity
• Blastx: Growth-regulating factor 12 from Oryza sativa with 85.11% of identity
• Eggnog: growth regulating factor protein(ENOG410YJFR)
• Kegg: Link to kegg annotations (4336731)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417341.1)
• Pfam: WRC (PF08879.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;