Transcript | Ll_transcript_360644 |
---|---|
CDS coordinates | 2-394 (+) |
Peptide sequence | LSSNDPEPGRCRRTDGKKWRCSRDVAPNHKYCERHMHRGRPRSRKPVEVHINNNNNDNQNQIKRARHDSNPFPASDVSVSISNNTTTKKDGCASQFVSSGASNPYLDASSLSLHHNFDSVASVSSNKEPR* |
ORF Type | 5prime_partial |
Blastp | Growth-regulating factor 12 from Oryza sativa with 85.11% of identity |
---|---|
Blastx | Growth-regulating factor 12 from Oryza sativa with 85.11% of identity |
Eggnog | growth regulating factor protein(ENOG410YJFR) |
Kegg | Link to kegg annotations (4336731) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417341.1) |
Pfam | WRC (PF08879.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer