Protein coding transcript 43527

• Transcript: Ll_transcript_360642
• CDS coordinates: 3-428 (+)
• Peptide sequence: LINGHFSSPSGTKNESKSLFETQDHVGGDGKSGGNMLRHFFDDWPRSLQQSSDSVGRANSVTCLTISMPESTSSDVSLKLSSGYGEEPCPRNGNVEAEAEQVQLNWAGGWTSTNQVASMGGPLAEALRSSTTTSSPTSVLH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_360642

• Blastp: Growth-regulating factor 3 from Arabidopsis with 48.82% of identity
• Blastx: Growth-regulating factor 3 from Arabidopsis with 46.9% of identity
• Eggnog: growth-regulating factor(ENOG410Y9TR)
• Kegg: Link to kegg annotations (AT2G36400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442382.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;