Protein coding transcript 43530

• Transcript: Ll_transcript_360655
• CDS coordinates: 1-582 (+)
• Peptide sequence: VVVGQKYCERHMHRGKNRSRKPVELPTPITIASSSSSISSPSLANASLKSPFDILQLNQCPSGTKNESKSLFETQDHVGGDGKSGGNMLRHFFDDWPRSLQQSSDSVGRANSVTCLTISMPESTSSDVSLKLSSGYGEEPCPRNGNVEAEAEQVQLNWAGGWTSTNQVASMGGPLAEALRSSTTTSSPTSVLH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_360655

• Blastp: Growth-regulating factor 4 from Arabidopsis with 42.45% of identity
• Blastx: Growth-regulating factor 4 from Arabidopsis with 40.2% of identity
• Eggnog: growth-regulating factor(ENOG410Y9TR)
• Kegg: Link to kegg annotations (AT3G52910)
• CantataDB: -
• Mirbase: osa-MIR396d (MI0013049)
• Ncbi protein: Link to NCBI protein (XP_019442382.1)
• Pfam: WRC (PF08879.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;