Protein coding transcript 43573

• Transcript: Ll_transcript_359410
• CDS coordinates: 1474-1893 (+)
• Peptide sequence: MVYINILSFVGYAPRYLVFQEKTGGKVIFRMMGVLYLFRGRNYNYRTRPYFPLMLWKPIPPVYPKLIRRVPESLTLDEATKMRQKGRDLIPICQIGKNGVYCNLVKNVREAFEECELVRINCQGLNKSDYRKIGAKLRD*
• ORF Type: complete

Annotations of Ll_transcript_359410

• Blastp: CRS2-associated factor 1, chloroplastic from Arabidopsis with 73.55% of identity
• Blastx: CRS2-associated factor 1, chloroplastic from Arabidopsis with 66.91% of identity
• Eggnog: CRS2-associated factor(ENOG410XQZ0)
• Kegg: Link to kegg annotations (AT2G20020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429199.1)
• Pfam: CRS1 / YhbY (CRM) domain (PF01985.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;