| Transcript | Ll_transcript_361028 |
|---|---|
| CDS coordinates | 104-448 (+) |
| Peptide sequence | MAPIAVGDVIPDGTLAYLDDENKPQSVSIHSLAKAKKVIIFGVPGAFTPTCSLKHVPGFIERAEELKGKGVDEVICISVNDPFVMNSWSKTFPENKHVKFLADGSAKYTYALGLE |
| ORF Type | 3prime_partial |
| Blastp | Peroxiredoxin-2 from Populus with 76.52% of identity |
|---|---|
| Blastx | Peroxiredoxin-2 from Populus with 76.52% of identity |
| Eggnog | peroxiredoxin(COG0678) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019448379.1) |
| Pfam | Redoxin (PF08534.9) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer