Protein coding transcript 43676

• Transcript: Ll_transcript_361002
• CDS coordinates: 3-833 (+)
• Peptide sequence: NRGPIFENFLMSHTYASVQYTRFNNHNNIISSRLNCQYRVAMTSGTAAVGGSSKTVGRWLKDRRERKKEETRAHNAQLHAAVTVAGVAAAVAAIAAATAASSSSGKDEQMAKTDMAVASAATLVAAQCVEAAEAMGAERDYLASVVSSAVNVRSASDITTITAAAATALRGAATLKARTLKEVWNIAAVIPVEKNLAVGGDSSSCHSRSSSSFSGELVPEENFLGICSRELLAGGCELLKRTRTGELHWKYVSVYINRMNQVIFLSIYSIRKKVYP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_361002

• Blastp: VAN3-binding protein from Arabidopsis with 62.9% of identity
• Blastx: VAN3-binding protein from Arabidopsis with 64.63% of identity
• Eggnog: Plant pleckstrin homology-like region(ENOG4111DWT)
• Kegg: Link to kegg annotations (AT3G63300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451595.1)
• Pfam: Auxin canalisation (PF05703.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;