Protein coding transcript 437

• Transcript: Ll_transcript_311703
• CDS coordinates: 3-701 (+)
• Peptide sequence: FLSQINFRNNAIFGQLPNLTNLVFLEQVILSNNHFSGPIPLDYVELPILEVLELQENYLDWQIPPFDQPSLTSFNVSYNHLVGPIPETSVFRRLRKSSFDNNSNICGKPLGTICPAAPSPATSSEVEKNKKRFHVWIIALIAAATALFLFLIIIAIQFNKRSSEKETRRNGSARYVFGAWAKKMVTYAGTSEDSERLGRLEFCNKKYAVFDIDDLLRASAEVLGKGNLGMTYK
• ORF Type: internal

Annotations of Ll_transcript_311703

• Blastp: Probable leucine-rich repeat receptor-like protein kinase At5g05160 from Arabidopsis with 36.03% of identity
• Blastx: Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630 from Arabidopsis with 33.33% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G05160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443251.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;