Protein coding transcript 43711

• Transcript: Ll_transcript_360208
• CDS coordinates: 2-682 (+)
• Peptide sequence: FVARDITFENYAGPEKHQAVALRVGADHAVVYRCSIIGYQDTCYVHSNRQFFRECDIYGTVDFIFGNAAVVFQKCNFYARKPMAQQKNTITAQNRKDPNQNTGISIHDCRILPAPDLATAQGSIPTYLGRPWKLYSRTVYLLSYIGDHVHPNGWLEWNGEFALDTLYYGEYMNYGPGAAIGQRVKWPGYRVITSTVEANRFTVAQFISGSAWLPSTGVAFLAGLST*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_360208

• Blastp: Probable pectinesterase/pectinesterase inhibitor 61 from Arabidopsis with 80% of identity
• Blastx: Probable pectinesterase/pectinesterase inhibitor 61 from Arabidopsis with 80% of identity
• Eggnog: pectinesterase(COG4677)
• Kegg: Link to kegg annotations (AT5G53370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419581.1)
• Pfam: Pectinesterase (PF01095.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;