Protein coding transcript 43715

• Transcript: Ll_transcript_360223
• CDS coordinates: 627-1049 (+)
• Peptide sequence: MDAVLAAPDYSMKRYVIYIKKGVYNEYVEIKKKKWNIMIIGDGIDATVISGNRSFIDGWTTFRSATFAVSGRGFIARDITFQNTAGPEKHQAVALRSDSDLSVFYRCGIFGYQDTLYTHTMRQFYRECRISGTVDFIFGDA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_360223

• Blastp: Pectinesterase/pectinesterase inhibitor PPE8B from Prunus with 89.29% of identity
• Blastx: Pectinesterase/pectinesterase inhibitor PPE8B from Prunus with 79.37% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419474.1)
• Pfam: Pectinesterase (PF01095.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;