Protein coding transcript 43716

• Transcript: Ll_transcript_360224
• CDS coordinates: 1515-2096 (+)
• Peptide sequence: MHNSTRNLSSDLRTWLSAALTYIDTCMNGLEETNINFNNLLISTKIDQVNSLVKNLLSKVDPISGQVSTQHVEFPSWVEPHDQNLLQTSEVAVDIVVAADGSGNYKTVMEAVNAAPEYSMRRFVVFIKKGVYIENVVIDKKKWNLMIIGEGMDETIISGSLYKTMNFTTYKTATFGKDTVLFLLSTSFSCSIV*
• ORF Type: complete

Annotations of Ll_transcript_360224

• Blastp: Pectinesterase/pectinesterase inhibitor PPE8B from Prunus with 55.75% of identity
• Blastx: Probable pectinesterase/pectinesterase inhibitor 44 from Arabidopsis with 66.8% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417377.1)
• Pfam: Plant invertase/pectin methylesterase inhibitor (PF04043.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;