| Transcript | Ll_transcript_360227 |
|---|---|
| CDS coordinates | 194-589 (+) |
| Peptide sequence | MASHSYTCSKMPLITFIFMLMLFVGFFTPLGSSIGTTHLSGSACLKVSSSEFVGLVREVNDILKQVSSILSKFSSGLGNFRLSHAISDCLDLLDLSSDELTWSESATQDPKGTILHSTLSYQTLMKPINHK* |
| ORF Type | complete |
| Blastp | Pectinesterase/pectinesterase inhibitor PPE8B from Prunus with 46.43% of identity |
|---|---|
| Blastx | Pectinesterase/pectinesterase inhibitor PPE8B from Prunus with 46.09% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019419474.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer