Protein coding transcript 43721

• Transcript: Ll_transcript_360232
• CDS coordinates: 40-1188 (+)
• Peptide sequence: MLKKEQHSCPLNMQITTISQYIFIPMALSSITFILFLVLFLCMCLPFDADASTYDNTVRSEFLKVTPSQFVGSVNEVVDVLQDVTSILSEVGNVFGDFRLSNAVSDCLDLLDLSSDELSWSVSATQSPKGMHNSTGKLSSDLRTWLSASLTNPETCMDGFEGTNNIVKGLVSNGLVQVISLVQQLLTQVNPVMDNFPFTNKGKFPGWVKPRDRKKLLQQNEVVVVDAIVAADGSGNYTKVMDAVKKAPNYSMRRFVIYVKRGVYNENVEIKKKKWNVMIIGDGMNETVISGNRSFVDGWTTFKSATFAVSGRGFIARDISFMNTAGPEKHQAVALRSDSDLSVFYRCGIFGYQDSLYAHTMRQFYRECKITGTVDFIFGNATV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_360232

• Blastp: Pectinesterase/pectinesterase inhibitor PPE8B from Prunus with 67.63% of identity
• Blastx: Pectinesterase/pectinesterase inhibitor PPE8B from Prunus with 68.73% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417375.1)
• Pfam: Plant invertase/pectin methylesterase inhibitor (PF04043.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;